Anti TMEM255B pAb (ATL-HPA043334)

Atlas Antibodies

Catalog No.:
ATL-HPA043334-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 255B
Gene Name: TMEM255B
Alternative Gene Name: FAM70B, MGC20579
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038457: 54%, ENSRNOG00000026336: 53%
Entrez Gene ID: 348013
Uniprot ID: Q8WV15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Gene Sequence VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Gene ID - Mouse ENSMUSG00000038457
Gene ID - Rat ENSRNOG00000026336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM255B pAb (ATL-HPA043334)
Datasheet Anti TMEM255B pAb (ATL-HPA043334) Datasheet (External Link)
Vendor Page Anti TMEM255B pAb (ATL-HPA043334) at Atlas Antibodies

Documents & Links for Anti TMEM255B pAb (ATL-HPA043334)
Datasheet Anti TMEM255B pAb (ATL-HPA043334) Datasheet (External Link)
Vendor Page Anti TMEM255B pAb (ATL-HPA043334)