Anti TMEM249 pAb (ATL-HPA078901)

Atlas Antibodies

Catalog No.:
ATL-HPA078901-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 249
Gene Name: TMEM249
Alternative Gene Name: C8orfK29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 24%,
Entrez Gene ID: 340393
Uniprot ID: Q2WGJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYL
Gene Sequence MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYL
Gene ID - Mouse ENSMUSG00000050700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM249 pAb (ATL-HPA078901)
Datasheet Anti TMEM249 pAb (ATL-HPA078901) Datasheet (External Link)
Vendor Page Anti TMEM249 pAb (ATL-HPA078901) at Atlas Antibodies

Documents & Links for Anti TMEM249 pAb (ATL-HPA078901)
Datasheet Anti TMEM249 pAb (ATL-HPA078901) Datasheet (External Link)
Vendor Page Anti TMEM249 pAb (ATL-HPA078901)