Anti TMEM247 pAb (ATL-HPA079482)

Atlas Antibodies

Catalog No.:
ATL-HPA079482-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 247
Gene Name: TMEM247
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037689: 53%, ENSRNOG00000046926: 52%
Entrez Gene ID: 388946
Uniprot ID: A6NEH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT
Gene Sequence SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT
Gene ID - Mouse ENSMUSG00000037689
Gene ID - Rat ENSRNOG00000046926
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM247 pAb (ATL-HPA079482)
Datasheet Anti TMEM247 pAb (ATL-HPA079482) Datasheet (External Link)
Vendor Page Anti TMEM247 pAb (ATL-HPA079482) at Atlas Antibodies

Documents & Links for Anti TMEM247 pAb (ATL-HPA079482)
Datasheet Anti TMEM247 pAb (ATL-HPA079482) Datasheet (External Link)
Vendor Page Anti TMEM247 pAb (ATL-HPA079482)