Anti TMEM241 pAb (ATL-HPA029489)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029489-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TMEM241
Alternative Gene Name: C18orf45, FLJ44259, MGC11386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049411: 64%, ENSRNOG00000023412: 61%
Entrez Gene ID: 85019
Uniprot ID: Q24JQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH |
| Gene Sequence | SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH |
| Gene ID - Mouse | ENSMUSG00000049411 |
| Gene ID - Rat | ENSRNOG00000023412 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM241 pAb (ATL-HPA029489) | |
| Datasheet | Anti TMEM241 pAb (ATL-HPA029489) Datasheet (External Link) |
| Vendor Page | Anti TMEM241 pAb (ATL-HPA029489) at Atlas Antibodies |
| Documents & Links for Anti TMEM241 pAb (ATL-HPA029489) | |
| Datasheet | Anti TMEM241 pAb (ATL-HPA029489) Datasheet (External Link) |
| Vendor Page | Anti TMEM241 pAb (ATL-HPA029489) |