Anti TMEM241 pAb (ATL-HPA029489)

Atlas Antibodies

Catalog No.: ATL-HPA029489-100

Protein Description: transmembrane protein 241
Gene Name: TMEM241
Alternative Gene Name: C18orf45, FLJ44259, MGC11386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049411: 64%, ENSRNOG00000023412: 61%
Entrez Gene ID: 85019
Uniprot ID: Q24JQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH
• Gene Sequence: SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH
• Gene ID - Mouse: ENSMUSG00000049411
• Gene ID - Rat: ENSRNOG00000023412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.