Anti TMEM234 pAb (ATL-HPA015049)

Atlas Antibodies

Catalog No.:
ATL-HPA015049-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 234
Gene Name: TMEM234
Alternative Gene Name: C1orf91, dJ622L5.7, FLJ90779, RP4-622L5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078253: 29%, ENSRNOG00000061192: 30%
Entrez Gene ID: 56063
Uniprot ID: Q8WY98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Gene Sequence DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Gene ID - Mouse ENSMUSG00000078253
Gene ID - Rat ENSRNOG00000061192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM234 pAb (ATL-HPA015049)
Datasheet Anti TMEM234 pAb (ATL-HPA015049) Datasheet (External Link)
Vendor Page Anti TMEM234 pAb (ATL-HPA015049) at Atlas Antibodies

Documents & Links for Anti TMEM234 pAb (ATL-HPA015049)
Datasheet Anti TMEM234 pAb (ATL-HPA015049) Datasheet (External Link)
Vendor Page Anti TMEM234 pAb (ATL-HPA015049)