Anti TMEM233 pAb (ATL-HPA075435)

Atlas Antibodies

Catalog No.:
ATL-HPA075435-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 233
Gene Name: TMEM233
Alternative Gene Name: IFITMD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079278: 71%, ENSRNOG00000053974: 71%
Entrez Gene ID: 387890
Uniprot ID: B4DJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLW
Gene Sequence PSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLW
Gene ID - Mouse ENSMUSG00000079278
Gene ID - Rat ENSRNOG00000053974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM233 pAb (ATL-HPA075435)
Datasheet Anti TMEM233 pAb (ATL-HPA075435) Datasheet (External Link)
Vendor Page Anti TMEM233 pAb (ATL-HPA075435) at Atlas Antibodies

Documents & Links for Anti TMEM233 pAb (ATL-HPA075435)
Datasheet Anti TMEM233 pAb (ATL-HPA075435) Datasheet (External Link)
Vendor Page Anti TMEM233 pAb (ATL-HPA075435)