Anti TMEM232 pAb (ATL-HPA049386)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049386-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM232
Alternative Gene Name: FLJ43080
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045036: 66%, ENSRNOG00000031348: 63%
Entrez Gene ID: 642987
Uniprot ID: C9JQI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QHLLRLQPYLYALSFSGASYHKYPNIFSNVQFILKASEIIGKRELRSESIFRPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSCVQ |
| Gene Sequence | QHLLRLQPYLYALSFSGASYHKYPNIFSNVQFILKASEIIGKRELRSESIFRPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSCVQ |
| Gene ID - Mouse | ENSMUSG00000045036 |
| Gene ID - Rat | ENSRNOG00000031348 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM232 pAb (ATL-HPA049386) | |
| Datasheet | Anti TMEM232 pAb (ATL-HPA049386) Datasheet (External Link) |
| Vendor Page | Anti TMEM232 pAb (ATL-HPA049386) at Atlas Antibodies |
| Documents & Links for Anti TMEM232 pAb (ATL-HPA049386) | |
| Datasheet | Anti TMEM232 pAb (ATL-HPA049386) Datasheet (External Link) |
| Vendor Page | Anti TMEM232 pAb (ATL-HPA049386) |