Anti TMEM229A pAb (ATL-HPA056391)

Atlas Antibodies

Catalog No.:
ATL-HPA056391-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 229A
Gene Name: TMEM229A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048022: 88%, ENSRNOG00000039464: 88%
Entrez Gene ID: 730130
Uniprot ID: B2RXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVFNFLLYPSAHVGLQTLAGQALLLSLGG
Gene Sequence SPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVFNFLLYPSAHVGLQTLAGQALLLSLGG
Gene ID - Mouse ENSMUSG00000048022
Gene ID - Rat ENSRNOG00000039464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM229A pAb (ATL-HPA056391)
Datasheet Anti TMEM229A pAb (ATL-HPA056391) Datasheet (External Link)
Vendor Page Anti TMEM229A pAb (ATL-HPA056391) at Atlas Antibodies

Documents & Links for Anti TMEM229A pAb (ATL-HPA056391)
Datasheet Anti TMEM229A pAb (ATL-HPA056391) Datasheet (External Link)
Vendor Page Anti TMEM229A pAb (ATL-HPA056391)