Anti TMEM223 pAb (ATL-HPA014504)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014504-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM223
Alternative Gene Name: MGC3196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010097: 89%, ENSRNOG00000058002: 100%
Entrez Gene ID: 79064
Uniprot ID: A0PJW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL |
| Gene Sequence | RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL |
| Gene ID - Mouse | ENSMUSG00000010097 |
| Gene ID - Rat | ENSRNOG00000058002 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM223 pAb (ATL-HPA014504) | |
| Datasheet | Anti TMEM223 pAb (ATL-HPA014504) Datasheet (External Link) |
| Vendor Page | Anti TMEM223 pAb (ATL-HPA014504) at Atlas Antibodies |
| Documents & Links for Anti TMEM223 pAb (ATL-HPA014504) | |
| Datasheet | Anti TMEM223 pAb (ATL-HPA014504) Datasheet (External Link) |
| Vendor Page | Anti TMEM223 pAb (ATL-HPA014504) |