Anti TMEM223 pAb (ATL-HPA014504)

Atlas Antibodies

Catalog No.:
ATL-HPA014504-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 223
Gene Name: TMEM223
Alternative Gene Name: MGC3196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010097: 89%, ENSRNOG00000058002: 100%
Entrez Gene ID: 79064
Uniprot ID: A0PJW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL
Gene Sequence RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL
Gene ID - Mouse ENSMUSG00000010097
Gene ID - Rat ENSRNOG00000058002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM223 pAb (ATL-HPA014504)
Datasheet Anti TMEM223 pAb (ATL-HPA014504) Datasheet (External Link)
Vendor Page Anti TMEM223 pAb (ATL-HPA014504) at Atlas Antibodies

Documents & Links for Anti TMEM223 pAb (ATL-HPA014504)
Datasheet Anti TMEM223 pAb (ATL-HPA014504) Datasheet (External Link)
Vendor Page Anti TMEM223 pAb (ATL-HPA014504)