Anti TMEM215 pAb (ATL-HPA063207)

Atlas Antibodies

Catalog No.:
ATL-HPA063207-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 215
Gene Name: TMEM215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046593: 94%, ENSRNOG00000042246: 94%
Entrez Gene ID: 401498
Uniprot ID: Q68D42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGE
Gene Sequence TEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGE
Gene ID - Mouse ENSMUSG00000046593
Gene ID - Rat ENSRNOG00000042246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM215 pAb (ATL-HPA063207)
Datasheet Anti TMEM215 pAb (ATL-HPA063207) Datasheet (External Link)
Vendor Page Anti TMEM215 pAb (ATL-HPA063207) at Atlas Antibodies

Documents & Links for Anti TMEM215 pAb (ATL-HPA063207)
Datasheet Anti TMEM215 pAb (ATL-HPA063207) Datasheet (External Link)
Vendor Page Anti TMEM215 pAb (ATL-HPA063207)