Anti TMEM215 pAb (ATL-HPA052804)

Atlas Antibodies

Catalog No.:
ATL-HPA052804-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 215
Gene Name: TMEM215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046593: 90%, ENSRNOG00000042246: 88%
Entrez Gene ID: 401498
Uniprot ID: Q68D42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETI
Gene Sequence PSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETI
Gene ID - Mouse ENSMUSG00000046593
Gene ID - Rat ENSRNOG00000042246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM215 pAb (ATL-HPA052804)
Datasheet Anti TMEM215 pAb (ATL-HPA052804) Datasheet (External Link)
Vendor Page Anti TMEM215 pAb (ATL-HPA052804) at Atlas Antibodies

Documents & Links for Anti TMEM215 pAb (ATL-HPA052804)
Datasheet Anti TMEM215 pAb (ATL-HPA052804) Datasheet (External Link)
Vendor Page Anti TMEM215 pAb (ATL-HPA052804)
Citations for Anti TMEM215 pAb (ATL-HPA052804) – 1 Found
Liu, Yuan; Zheng, Qijun; He, Guangbin; Zhang, Mei; Yan, Xianchun; Yang, Ziyan; Zhang, Peiran; Wang, Lili; Liu, Jiankang; Liang, Liang; Han, Hua. Transmembrane protein 215 promotes angiogenesis by maintaining endothelial cell survival. Journal Of Cellular Physiology. 2019;234(6):9525-9534.  PubMed