Anti TMEM204 pAb (ATL-HPA014028 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014028-25

Protein Description: transmembrane protein 204
Gene Name: TMEM204
Alternative Gene Name: C16orf30, FLJ20898
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024168: 97%, ENSRNOG00000016494: 97%
Entrez Gene ID: 79652
Uniprot ID: Q9BSN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
• Gene Sequence: HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
• Gene ID - Mouse: ENSMUSG00000024168
• Gene ID - Rat: ENSRNOG00000016494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.