Anti TMEM200C pAb (ATL-HPA050490)

Atlas Antibodies

Catalog No.:
ATL-HPA050490-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 200C
Gene Name: TMEM200C
Alternative Gene Name: TTMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095407: 59%, ENSRNOG00000049880: 57%
Entrez Gene ID: 645369
Uniprot ID: A6NKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA
Gene Sequence GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA
Gene ID - Mouse ENSMUSG00000095407
Gene ID - Rat ENSRNOG00000049880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM200C pAb (ATL-HPA050490)
Datasheet Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link)
Vendor Page Anti TMEM200C pAb (ATL-HPA050490) at Atlas Antibodies

Documents & Links for Anti TMEM200C pAb (ATL-HPA050490)
Datasheet Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link)
Vendor Page Anti TMEM200C pAb (ATL-HPA050490)