Anti TMEM200C pAb (ATL-HPA050490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050490-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM200C
Alternative Gene Name: TTMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095407: 59%, ENSRNOG00000049880: 57%
Entrez Gene ID: 645369
Uniprot ID: A6NKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA |
Gene Sequence | GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA |
Gene ID - Mouse | ENSMUSG00000095407 |
Gene ID - Rat | ENSRNOG00000049880 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM200C pAb (ATL-HPA050490) | |
Datasheet | Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link) |
Vendor Page | Anti TMEM200C pAb (ATL-HPA050490) at Atlas Antibodies |
Documents & Links for Anti TMEM200C pAb (ATL-HPA050490) | |
Datasheet | Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link) |
Vendor Page | Anti TMEM200C pAb (ATL-HPA050490) |