Anti TMEM200C pAb (ATL-HPA050490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050490-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM200C
Alternative Gene Name: TTMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095407: 59%, ENSRNOG00000049880: 57%
Entrez Gene ID: 645369
Uniprot ID: A6NKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA |
| Gene Sequence | GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA |
| Gene ID - Mouse | ENSMUSG00000095407 |
| Gene ID - Rat | ENSRNOG00000049880 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM200C pAb (ATL-HPA050490) | |
| Datasheet | Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link) |
| Vendor Page | Anti TMEM200C pAb (ATL-HPA050490) at Atlas Antibodies |
| Documents & Links for Anti TMEM200C pAb (ATL-HPA050490) | |
| Datasheet | Anti TMEM200C pAb (ATL-HPA050490) Datasheet (External Link) |
| Vendor Page | Anti TMEM200C pAb (ATL-HPA050490) |