Anti TMEM200B pAb (ATL-HPA055254)

Atlas Antibodies

Catalog No.:
ATL-HPA055254-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 200B
Gene Name: TMEM200B
Alternative Gene Name: TTMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070720: 96%, ENSRNOG00000032018: 97%
Entrez Gene ID: 399474
Uniprot ID: Q69YZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPRLGLPALLNSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRS
Gene Sequence NPRLGLPALLNSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRS
Gene ID - Mouse ENSMUSG00000070720
Gene ID - Rat ENSRNOG00000032018
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM200B pAb (ATL-HPA055254)
Datasheet Anti TMEM200B pAb (ATL-HPA055254) Datasheet (External Link)
Vendor Page Anti TMEM200B pAb (ATL-HPA055254) at Atlas Antibodies

Documents & Links for Anti TMEM200B pAb (ATL-HPA055254)
Datasheet Anti TMEM200B pAb (ATL-HPA055254) Datasheet (External Link)
Vendor Page Anti TMEM200B pAb (ATL-HPA055254)