Anti TMEM200A pAb (ATL-HPA014396)

Atlas Antibodies

Catalog No.:
ATL-HPA014396-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 200A
Gene Name: TMEM200A
Alternative Gene Name: KIAA1913, TTMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049420: 95%, ENSRNOG00000047783: 95%
Entrez Gene ID: 114801
Uniprot ID: Q86VY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKM
Gene Sequence EHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKM
Gene ID - Mouse ENSMUSG00000049420
Gene ID - Rat ENSRNOG00000047783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM200A pAb (ATL-HPA014396)
Datasheet Anti TMEM200A pAb (ATL-HPA014396) Datasheet (External Link)
Vendor Page Anti TMEM200A pAb (ATL-HPA014396) at Atlas Antibodies

Documents & Links for Anti TMEM200A pAb (ATL-HPA014396)
Datasheet Anti TMEM200A pAb (ATL-HPA014396) Datasheet (External Link)
Vendor Page Anti TMEM200A pAb (ATL-HPA014396)