Anti TMEM198 pAb (ATL-HPA042385)

Atlas Antibodies

Catalog No.:
ATL-HPA042385-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 198
Gene Name: TMEM198
Alternative Gene Name: MGC99813, TMEM198A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051703: 91%, ENSRNOG00000020061: 88%
Entrez Gene ID: 130612
Uniprot ID: Q66K66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQ
Gene Sequence GTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQ
Gene ID - Mouse ENSMUSG00000051703
Gene ID - Rat ENSRNOG00000020061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM198 pAb (ATL-HPA042385)
Datasheet Anti TMEM198 pAb (ATL-HPA042385) Datasheet (External Link)
Vendor Page Anti TMEM198 pAb (ATL-HPA042385) at Atlas Antibodies

Documents & Links for Anti TMEM198 pAb (ATL-HPA042385)
Datasheet Anti TMEM198 pAb (ATL-HPA042385) Datasheet (External Link)
Vendor Page Anti TMEM198 pAb (ATL-HPA042385)