Anti TMEM189 pAb (ATL-HPA059549)

Atlas Antibodies

Catalog No.:
ATL-HPA059549-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 189
Gene Name: TMEM189
Alternative Gene Name: Kua
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090213: 98%, ENSRNOG00000060571: 93%
Entrez Gene ID: 387521
Uniprot ID: A5PLL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKI
Gene Sequence YFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKI
Gene ID - Mouse ENSMUSG00000090213
Gene ID - Rat ENSRNOG00000060571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM189 pAb (ATL-HPA059549)
Datasheet Anti TMEM189 pAb (ATL-HPA059549) Datasheet (External Link)
Vendor Page Anti TMEM189 pAb (ATL-HPA059549) at Atlas Antibodies

Documents & Links for Anti TMEM189 pAb (ATL-HPA059549)
Datasheet Anti TMEM189 pAb (ATL-HPA059549) Datasheet (External Link)
Vendor Page Anti TMEM189 pAb (ATL-HPA059549)