Anti TMEM186 pAb (ATL-HPA063559)

Atlas Antibodies

Catalog No.:
ATL-HPA063559-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 186
Gene Name: TMEM186
Alternative Gene Name: C16orf51, DKFZP564K2062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043140: 72%, ENSRNOG00000027087: 70%
Entrez Gene ID: 25880
Uniprot ID: Q96B77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK
Gene Sequence LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK
Gene ID - Mouse ENSMUSG00000043140
Gene ID - Rat ENSRNOG00000027087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM186 pAb (ATL-HPA063559)
Datasheet Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link)
Vendor Page Anti TMEM186 pAb (ATL-HPA063559) at Atlas Antibodies

Documents & Links for Anti TMEM186 pAb (ATL-HPA063559)
Datasheet Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link)
Vendor Page Anti TMEM186 pAb (ATL-HPA063559)