Anti TMEM186 pAb (ATL-HPA063559)
Atlas Antibodies
- SKU:
- ATL-HPA063559-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM186
Alternative Gene Name: C16orf51, DKFZP564K2062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043140: 72%, ENSRNOG00000027087: 70%
Entrez Gene ID: 25880
Uniprot ID: Q96B77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK |
Gene Sequence | LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK |
Gene ID - Mouse | ENSMUSG00000043140 |
Gene ID - Rat | ENSRNOG00000027087 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM186 pAb (ATL-HPA063559) | |
Datasheet | Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link) |
Vendor Page | Anti TMEM186 pAb (ATL-HPA063559) at Atlas Antibodies |
Documents & Links for Anti TMEM186 pAb (ATL-HPA063559) | |
Datasheet | Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link) |
Vendor Page | Anti TMEM186 pAb (ATL-HPA063559) |