Anti TMEM184A pAb (ATL-HPA053790)

Atlas Antibodies

Catalog No.:
ATL-HPA053790-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 184A
Gene Name: TMEM184A
Alternative Gene Name: MGC9712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036687: 63%, ENSRNOG00000001275: 63%
Entrez Gene ID: 202915
Uniprot ID: Q6ZMB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSE
Gene Sequence AYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSE
Gene ID - Mouse ENSMUSG00000036687
Gene ID - Rat ENSRNOG00000001275
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM184A pAb (ATL-HPA053790)
Datasheet Anti TMEM184A pAb (ATL-HPA053790) Datasheet (External Link)
Vendor Page Anti TMEM184A pAb (ATL-HPA053790) at Atlas Antibodies

Documents & Links for Anti TMEM184A pAb (ATL-HPA053790)
Datasheet Anti TMEM184A pAb (ATL-HPA053790) Datasheet (External Link)
Vendor Page Anti TMEM184A pAb (ATL-HPA053790)