Anti TMEM183A pAb (ATL-HPA072607)

Atlas Antibodies

Catalog No.:
ATL-HPA072607-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 183A
Gene Name: TMEM183A
Alternative Gene Name: C1orf37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042305: 95%, ENSRNOG00000003594: 96%
Entrez Gene ID: 92703
Uniprot ID: Q8IXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPTEEALSGAGE
Gene Sequence VAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPTEEALSGAGE
Gene ID - Mouse ENSMUSG00000042305
Gene ID - Rat ENSRNOG00000003594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM183A pAb (ATL-HPA072607)
Datasheet Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link)
Vendor Page Anti TMEM183A pAb (ATL-HPA072607) at Atlas Antibodies

Documents & Links for Anti TMEM183A pAb (ATL-HPA072607)
Datasheet Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link)
Vendor Page Anti TMEM183A pAb (ATL-HPA072607)