Anti TMEM183A pAb (ATL-HPA072607)
Atlas Antibodies
- SKU:
- ATL-HPA072607-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TMEM183A
Alternative Gene Name: C1orf37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042305: 95%, ENSRNOG00000003594: 96%
Entrez Gene ID: 92703
Uniprot ID: Q8IXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPTEEALSGAGE |
Gene Sequence | VAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPTEEALSGAGE |
Gene ID - Mouse | ENSMUSG00000042305 |
Gene ID - Rat | ENSRNOG00000003594 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM183A pAb (ATL-HPA072607) | |
Datasheet | Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link) |
Vendor Page | Anti TMEM183A pAb (ATL-HPA072607) at Atlas Antibodies |
Documents & Links for Anti TMEM183A pAb (ATL-HPA072607) | |
Datasheet | Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link) |
Vendor Page | Anti TMEM183A pAb (ATL-HPA072607) |