Anti TMEM179B pAb (ATL-HPA062068)

Atlas Antibodies

Catalog No.:
ATL-HPA062068-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 179B
Gene Name: TMEM179B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003680: 71%, ENSRNOG00000019341: 79%
Entrez Gene ID: 374395
Uniprot ID: Q7Z7N9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
Gene Sequence QWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
Gene ID - Mouse ENSMUSG00000003680
Gene ID - Rat ENSRNOG00000019341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM179B pAb (ATL-HPA062068)
Datasheet Anti TMEM179B pAb (ATL-HPA062068) Datasheet (External Link)
Vendor Page Anti TMEM179B pAb (ATL-HPA062068) at Atlas Antibodies

Documents & Links for Anti TMEM179B pAb (ATL-HPA062068)
Datasheet Anti TMEM179B pAb (ATL-HPA062068) Datasheet (External Link)
Vendor Page Anti TMEM179B pAb (ATL-HPA062068)