Anti TMEM177 pAb (ATL-HPA053816)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053816-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMEM177
Alternative Gene Name: MGC10993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036975: 81%, ENSRNOG00000025484: 80%
Entrez Gene ID: 80775
Uniprot ID: Q53S58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKEGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS |
| Gene Sequence | SQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKEGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS |
| Gene ID - Mouse | ENSMUSG00000036975 |
| Gene ID - Rat | ENSRNOG00000025484 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM177 pAb (ATL-HPA053816) | |
| Datasheet | Anti TMEM177 pAb (ATL-HPA053816) Datasheet (External Link) |
| Vendor Page | Anti TMEM177 pAb (ATL-HPA053816) at Atlas Antibodies |
| Documents & Links for Anti TMEM177 pAb (ATL-HPA053816) | |
| Datasheet | Anti TMEM177 pAb (ATL-HPA053816) Datasheet (External Link) |
| Vendor Page | Anti TMEM177 pAb (ATL-HPA053816) |