Anti TMEM177 pAb (ATL-HPA053816)

Atlas Antibodies

Catalog No.:
ATL-HPA053816-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 177
Gene Name: TMEM177
Alternative Gene Name: MGC10993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036975: 81%, ENSRNOG00000025484: 80%
Entrez Gene ID: 80775
Uniprot ID: Q53S58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKEGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS
Gene Sequence SQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKEGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS
Gene ID - Mouse ENSMUSG00000036975
Gene ID - Rat ENSRNOG00000025484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM177 pAb (ATL-HPA053816)
Datasheet Anti TMEM177 pAb (ATL-HPA053816) Datasheet (External Link)
Vendor Page Anti TMEM177 pAb (ATL-HPA053816) at Atlas Antibodies

Documents & Links for Anti TMEM177 pAb (ATL-HPA053816)
Datasheet Anti TMEM177 pAb (ATL-HPA053816) Datasheet (External Link)
Vendor Page Anti TMEM177 pAb (ATL-HPA053816)