Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038534-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 173
Gene Name: TMEM173
Alternative Gene Name: FLJ38577, NET23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024349: 76%, ENSRNOG00000042137: 72%
Entrez Gene ID: 340061
Uniprot ID: Q86WV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
Gene Sequence RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
Gene ID - Mouse ENSMUSG00000024349
Gene ID - Rat ENSRNOG00000042137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation)
Datasheet Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation)
Datasheet Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation)
Citations for Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation) – 1 Found
Neufeldt, Christopher J; Cerikan, Berati; Cortese, Mirko; Frankish, Jamie; Lee, Ji-Young; Plociennikowska, Agnieszka; Heigwer, Florian; Prasad, Vibhu; Joecks, Sebastian; Burkart, Sandy S; Zander, David Y; Subramanian, Baskaran; Gimi, Rayomand; Padmanabhan, Seetharamaiyer; Iyer, Radhakrishnan; Gendarme, Mathieu; El Debs, Bachir; Halama, Niels; Merle, Uta; Boutros, Michael; Binder, Marco; Bartenschlager, Ralf. SARS-CoV-2 infection induces a pro-inflammatory cytokine response through cGAS-STING and NF-κB. Communications Biology. 2022;5(1):45.  PubMed