Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038534-25

Protein Description: transmembrane protein 173
Gene Name: TMEM173
Alternative Gene Name: FLJ38577, NET23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024349: 76%, ENSRNOG00000042137: 72%
Entrez Gene ID: 340061
Uniprot ID: Q86WV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
• Gene Sequence: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
• Gene ID - Mouse: ENSMUSG00000024349
• Gene ID - Rat: ENSRNOG00000042137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM173 pAb (ATL-HPA038534 w/enhanced validation) – 1 Found

Neufeldt, Christopher J; Cerikan, Berati; Cortese, Mirko; Frankish, Jamie; Lee, Ji-Young; Plociennikowska, Agnieszka; Heigwer, Florian; Prasad, Vibhu; Joecks, Sebastian; Burkart, Sandy S; Zander, David Y; Subramanian, Baskaran; Gimi, Rayomand; Padmanabhan, Seetharamaiyer; Iyer, Radhakrishnan; Gendarme, Mathieu; El Debs, Bachir; Halama, Niels; Merle, Uta; Boutros, Michael; Binder, Marco; Bartenschlager, Ralf. SARS-CoV-2 infection induces a pro-inflammatory cytokine response through cGAS-STING and NF-κB. Communications Biology. 2022;5(1):45.