Anti TMEM170A pAb (ATL-HPA055071)

Atlas Antibodies

Catalog No.:
ATL-HPA055071-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 170A
Gene Name: TMEM170A
Alternative Gene Name: FLJ37611, TMEM170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031953: 97%, ENSRNOG00000049019: 58%
Entrez Gene ID: 124491
Uniprot ID: Q8WVE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM
Gene Sequence LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM
Gene ID - Mouse ENSMUSG00000031953
Gene ID - Rat ENSRNOG00000049019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM170A pAb (ATL-HPA055071)
Datasheet Anti TMEM170A pAb (ATL-HPA055071) Datasheet (External Link)
Vendor Page Anti TMEM170A pAb (ATL-HPA055071) at Atlas Antibodies

Documents & Links for Anti TMEM170A pAb (ATL-HPA055071)
Datasheet Anti TMEM170A pAb (ATL-HPA055071) Datasheet (External Link)
Vendor Page Anti TMEM170A pAb (ATL-HPA055071)