Anti TMEM168 pAb (ATL-HPA077143)

Atlas Antibodies

SKU:
ATL-HPA077143-25
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 168
Gene Name: TMEM168
Alternative Gene Name: DKFZp564C012, FLJ13576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029569: 95%, ENSRNOG00000057290: 95%
Entrez Gene ID: 64418
Uniprot ID: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE
Gene Sequence YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE
Gene ID - Mouse ENSMUSG00000029569
Gene ID - Rat ENSRNOG00000057290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM168 pAb (ATL-HPA077143)
Datasheet Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link)
Vendor Page Anti TMEM168 pAb (ATL-HPA077143) at Atlas Antibodies

Documents & Links for Anti TMEM168 pAb (ATL-HPA077143)
Datasheet Anti TMEM168 pAb (ATL-HPA077143) Datasheet (External Link)
Vendor Page Anti TMEM168 pAb (ATL-HPA077143)