Anti TMEM158 pAb (ATL-HPA074974)

Atlas Antibodies

Catalog No.:
ATL-HPA074974-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 158 (gene/pseudogene)
Gene Name: TMEM158
Alternative Gene Name: p40BBp, RIS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054871: 96%, ENSRNOG00000004757: 96%
Entrez Gene ID: 25907
Uniprot ID: Q8WZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL
Gene Sequence TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL
Gene ID - Mouse ENSMUSG00000054871
Gene ID - Rat ENSRNOG00000004757
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM158 pAb (ATL-HPA074974)
Datasheet Anti TMEM158 pAb (ATL-HPA074974) Datasheet (External Link)
Vendor Page Anti TMEM158 pAb (ATL-HPA074974) at Atlas Antibodies

Documents & Links for Anti TMEM158 pAb (ATL-HPA074974)
Datasheet Anti TMEM158 pAb (ATL-HPA074974) Datasheet (External Link)
Vendor Page Anti TMEM158 pAb (ATL-HPA074974)