Anti TMEM155 pAb (ATL-HPA077585)

Atlas Antibodies

Catalog No.:
ATL-HPA077585-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 155
Gene Name: TMEM155
Alternative Gene Name: FLJ30834
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078486: 30%, ENSRNOG00000023187: 27%
Entrez Gene ID: 132332
Uniprot ID: Q4W5P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTR
Gene Sequence AVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTR
Gene ID - Mouse ENSMUSG00000078486
Gene ID - Rat ENSRNOG00000023187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM155 pAb (ATL-HPA077585)
Datasheet Anti TMEM155 pAb (ATL-HPA077585) Datasheet (External Link)
Vendor Page Anti TMEM155 pAb (ATL-HPA077585) at Atlas Antibodies

Documents & Links for Anti TMEM155 pAb (ATL-HPA077585)
Datasheet Anti TMEM155 pAb (ATL-HPA077585) Datasheet (External Link)
Vendor Page Anti TMEM155 pAb (ATL-HPA077585)