Anti TMEM154 pAb (ATL-HPA019184)

Atlas Antibodies

Catalog No.:
ATL-HPA019184-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 154
Gene Name: TMEM154
Alternative Gene Name: FLJ32028
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056498: 40%, ENSRNOG00000042916: 31%
Entrez Gene ID: 201799
Uniprot ID: Q6P9G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPDENQL
Gene Sequence EELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPDENQL
Gene ID - Mouse ENSMUSG00000056498
Gene ID - Rat ENSRNOG00000042916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM154 pAb (ATL-HPA019184)
Datasheet Anti TMEM154 pAb (ATL-HPA019184) Datasheet (External Link)
Vendor Page Anti TMEM154 pAb (ATL-HPA019184) at Atlas Antibodies

Documents & Links for Anti TMEM154 pAb (ATL-HPA019184)
Datasheet Anti TMEM154 pAb (ATL-HPA019184) Datasheet (External Link)
Vendor Page Anti TMEM154 pAb (ATL-HPA019184)