Anti TMEM132E pAb (ATL-HPA070608)

Atlas Antibodies

Catalog No.:
ATL-HPA070608-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 132E
Gene Name: TMEM132E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020701: 91%, ENSRNOG00000007455: 89%
Entrez Gene ID: 124842
Uniprot ID: Q6IEE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHTILATTAAQQTLSFLKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELL
Gene Sequence SHTILATTAAQQTLSFLKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELL
Gene ID - Mouse ENSMUSG00000020701
Gene ID - Rat ENSRNOG00000007455
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM132E pAb (ATL-HPA070608)
Datasheet Anti TMEM132E pAb (ATL-HPA070608) Datasheet (External Link)
Vendor Page Anti TMEM132E pAb (ATL-HPA070608) at Atlas Antibodies

Documents & Links for Anti TMEM132E pAb (ATL-HPA070608)
Datasheet Anti TMEM132E pAb (ATL-HPA070608) Datasheet (External Link)
Vendor Page Anti TMEM132E pAb (ATL-HPA070608)