Anti TMEM132E pAb (ATL-HPA070608)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070608-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM132E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020701: 91%, ENSRNOG00000007455: 89%
Entrez Gene ID: 124842
Uniprot ID: Q6IEE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SHTILATTAAQQTLSFLKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELL |
Gene Sequence | SHTILATTAAQQTLSFLKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELL |
Gene ID - Mouse | ENSMUSG00000020701 |
Gene ID - Rat | ENSRNOG00000007455 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM132E pAb (ATL-HPA070608) | |
Datasheet | Anti TMEM132E pAb (ATL-HPA070608) Datasheet (External Link) |
Vendor Page | Anti TMEM132E pAb (ATL-HPA070608) at Atlas Antibodies |
Documents & Links for Anti TMEM132E pAb (ATL-HPA070608) | |
Datasheet | Anti TMEM132E pAb (ATL-HPA070608) Datasheet (External Link) |
Vendor Page | Anti TMEM132E pAb (ATL-HPA070608) |