Anti TMEM126B pAb (ATL-HPA019186 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019186-25

Protein Description: transmembrane protein 126B
Gene Name: TMEM126B
Alternative Gene Name: HT007
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030614: 69%, ENSRNOG00000022732: 69%
Entrez Gene ID: 55863
Uniprot ID: Q8IUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC
• Gene Sequence: VKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC
• Gene ID - Mouse: ENSMUSG00000030614
• Gene ID - Rat: ENSRNOG00000022732
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.