Anti TMEM125 pAb (ATL-HPA015796 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015796-100

Protein Description: transmembrane protein 125
Gene Name: TMEM125
Alternative Gene Name: MGC17299
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050854: 71%, ENSRNOG00000006924: 71%
Entrez Gene ID: 128218
Uniprot ID: Q96AQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEQEAQAPGGRGLPPDMLAEQVELWWSQQP
• Gene Sequence: MSEQEAQAPGGRGLPPDMLAEQVELWWSQQP
• Gene ID - Mouse: ENSMUSG00000050854
• Gene ID - Rat: ENSRNOG00000006924
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.