Anti TMEM123 pAb (ATL-HPA062862)

Atlas Antibodies

Catalog No.:
ATL-HPA062862-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 123
Gene Name: TMEM123
Alternative Gene Name: KCT3, PORIMIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042520: 34%, ENSRNOG00000056817: 33%
Entrez Gene ID: 114908
Uniprot ID: Q8N131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA
Gene Sequence ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA
Gene ID - Mouse ENSMUSG00000042520
Gene ID - Rat ENSRNOG00000056817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM123 pAb (ATL-HPA062862)
Datasheet Anti TMEM123 pAb (ATL-HPA062862) Datasheet (External Link)
Vendor Page Anti TMEM123 pAb (ATL-HPA062862) at Atlas Antibodies

Documents & Links for Anti TMEM123 pAb (ATL-HPA062862)
Datasheet Anti TMEM123 pAb (ATL-HPA062862) Datasheet (External Link)
Vendor Page Anti TMEM123 pAb (ATL-HPA062862)