Anti TMEM123 pAb (ATL-HPA062862)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062862-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TMEM123
Alternative Gene Name: KCT3, PORIMIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042520: 34%, ENSRNOG00000056817: 33%
Entrez Gene ID: 114908
Uniprot ID: Q8N131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA |
Gene Sequence | ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA |
Gene ID - Mouse | ENSMUSG00000042520 |
Gene ID - Rat | ENSRNOG00000056817 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM123 pAb (ATL-HPA062862) | |
Datasheet | Anti TMEM123 pAb (ATL-HPA062862) Datasheet (External Link) |
Vendor Page | Anti TMEM123 pAb (ATL-HPA062862) at Atlas Antibodies |
Documents & Links for Anti TMEM123 pAb (ATL-HPA062862) | |
Datasheet | Anti TMEM123 pAb (ATL-HPA062862) Datasheet (External Link) |
Vendor Page | Anti TMEM123 pAb (ATL-HPA062862) |