Anti TMEM121 pAb (ATL-HPA049857)

Atlas Antibodies

Catalog No.:
ATL-HPA049857-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 121
Gene Name: TMEM121
Alternative Gene Name: hole, MGC4659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049036: 96%, ENSRNOG00000005174: 96%
Entrez Gene ID: 80757
Uniprot ID: Q9BTD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVP
Gene Sequence RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVP
Gene ID - Mouse ENSMUSG00000049036
Gene ID - Rat ENSRNOG00000005174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM121 pAb (ATL-HPA049857)
Datasheet Anti TMEM121 pAb (ATL-HPA049857) Datasheet (External Link)
Vendor Page Anti TMEM121 pAb (ATL-HPA049857) at Atlas Antibodies

Documents & Links for Anti TMEM121 pAb (ATL-HPA049857)
Datasheet Anti TMEM121 pAb (ATL-HPA049857) Datasheet (External Link)
Vendor Page Anti TMEM121 pAb (ATL-HPA049857)