Anti TMEM121 pAb (ATL-HPA049857)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049857-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMEM121
Alternative Gene Name: hole, MGC4659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049036: 96%, ENSRNOG00000005174: 96%
Entrez Gene ID: 80757
Uniprot ID: Q9BTD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVP |
| Gene Sequence | RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVP |
| Gene ID - Mouse | ENSMUSG00000049036 |
| Gene ID - Rat | ENSRNOG00000005174 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM121 pAb (ATL-HPA049857) | |
| Datasheet | Anti TMEM121 pAb (ATL-HPA049857) Datasheet (External Link) |
| Vendor Page | Anti TMEM121 pAb (ATL-HPA049857) at Atlas Antibodies |
| Documents & Links for Anti TMEM121 pAb (ATL-HPA049857) | |
| Datasheet | Anti TMEM121 pAb (ATL-HPA049857) Datasheet (External Link) |
| Vendor Page | Anti TMEM121 pAb (ATL-HPA049857) |