Anti TMEM108 pAb (ATL-HPA063350)

Atlas Antibodies

SKU:
ATL-HPA063350-25
  • Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane, cytosol & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 108
Gene Name: TMEM108
Alternative Gene Name: CT124, MGC3040
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042757: 65%, ENSRNOG00000010911: 67%
Entrez Gene ID: 66000
Uniprot ID: Q6UXF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP
Gene Sequence EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP
Gene ID - Mouse ENSMUSG00000042757
Gene ID - Rat ENSRNOG00000010911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM108 pAb (ATL-HPA063350)
Datasheet Anti TMEM108 pAb (ATL-HPA063350) Datasheet (External Link)
Vendor Page Anti TMEM108 pAb (ATL-HPA063350) at Atlas Antibodies

Documents & Links for Anti TMEM108 pAb (ATL-HPA063350)
Datasheet Anti TMEM108 pAb (ATL-HPA063350) Datasheet (External Link)
Vendor Page Anti TMEM108 pAb (ATL-HPA063350)