Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047204-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 106C
Gene Name: TMEM106C
Alternative Gene Name: MGC5576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052369: 77%, ENSRNOG00000053269: 67%
Entrez Gene ID: 79022
Uniprot ID: Q9BVX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Gene Sequence SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Gene ID - Mouse ENSMUSG00000052369
Gene ID - Rat ENSRNOG00000053269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation)
Datasheet Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation)
Datasheet Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation)