Anti TMEM101 pAb (ATL-HPA039739)

Atlas Antibodies

Catalog No.:
ATL-HPA039739-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 101
Gene Name: TMEM101
Alternative Gene Name: FLJ23987, MGC4251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020921: 94%, ENSRNOG00000054581: 94%
Entrez Gene ID: 84336
Uniprot ID: Q96IK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVIL
Gene Sequence IDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVIL
Gene ID - Mouse ENSMUSG00000020921
Gene ID - Rat ENSRNOG00000054581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM101 pAb (ATL-HPA039739)
Datasheet Anti TMEM101 pAb (ATL-HPA039739) Datasheet (External Link)
Vendor Page Anti TMEM101 pAb (ATL-HPA039739) at Atlas Antibodies

Documents & Links for Anti TMEM101 pAb (ATL-HPA039739)
Datasheet Anti TMEM101 pAb (ATL-HPA039739) Datasheet (External Link)
Vendor Page Anti TMEM101 pAb (ATL-HPA039739)