Anti TMEFF2 pAb (ATL-HPA015587)

Atlas Antibodies

Catalog No.: ATL-HPA015587-25

Protein Description: transmembrane protein with EGF-like and two follistatin-like domains 2
Gene Name: TMEFF2
Alternative Gene Name: CT120.2, HPP1, TENB2, TPEF, TR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026109: 99%, ENSRNOG00000016623: 99%
Entrez Gene ID: 23671
Uniprot ID: Q9UIK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA
• Gene Sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA
• Gene ID - Mouse: ENSMUSG00000026109
• Gene ID - Rat: ENSRNOG00000016623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEFF2 pAb (ATL-HPA015587) – 3 Found

Georgescu, Constantin; Corbin, Joshua M; Thibivilliers, Sandra; Webb, Zachary D; Zhao, Yan D; Koster, Jan; Fung, Kar-Ming; Asch, Adam S; Wren, Jonathan D; Ruiz-Echevarría, Maria J. A TMEFF2-regulated cell cycle derived gene signature is prognostic of recurrence risk in prostate cancer. Bmc Cancer. 2019;19(1):423. 

Corbin, Joshua M; Overcash, Ryan F; Wren, Jonathan D; Coburn, Anita; Tipton, Greg J; Ezzell, Jennifer A; McNaughton, Kirk K; Fung, Kar-Ming; Kosanke, Stanley D; Ruiz-Echevarria, Maria J. Analysis of TMEFF2 allografts and transgenic mouse models reveals roles in prostate regeneration and cancer. The Prostate. 2016;76(1):97-113. 

Corbin, Joshua M; Georgescu, Constantin; Wren, Jonathan D; Xu, Chao; Asch, Adam S; Ruiz-Echevarría, Maria J. Seed-mediated RNA interference of androgen signaling and survival networks induces cell death in prostate cancer cells. Molecular Therapy. Nucleic Acids. 2021;24( 33850637):337-351.