Anti TMED5 pAb (ATL-HPA050289)

Atlas Antibodies

Catalog No.:
ATL-HPA050289-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane emp24 protein transport domain containing 5
Gene Name: TMED5
Alternative Gene Name: CGI-100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063406: 89%, ENSRNOG00000000073: 88%
Entrez Gene ID: 50999
Uniprot ID: Q9Y3A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL
Gene Sequence FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL
Gene ID - Mouse ENSMUSG00000063406
Gene ID - Rat ENSRNOG00000000073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMED5 pAb (ATL-HPA050289)
Datasheet Anti TMED5 pAb (ATL-HPA050289) Datasheet (External Link)
Vendor Page Anti TMED5 pAb (ATL-HPA050289) at Atlas Antibodies

Documents & Links for Anti TMED5 pAb (ATL-HPA050289)
Datasheet Anti TMED5 pAb (ATL-HPA050289) Datasheet (External Link)
Vendor Page Anti TMED5 pAb (ATL-HPA050289)
Citations for Anti TMED5 pAb (ATL-HPA050289) – 1 Found
Nguyen, Duy; Stutz, Regine; Schorr, Stefan; Lang, Sven; Pfeffer, Stefan; Freeze, Hudson H; Förster, Friedrich; Helms, Volkhard; Dudek, Johanna; Zimmermann, Richard. Proteomics reveals signal peptide features determining the client specificity in human TRAP-dependent ER protein import. Nature Communications. 2018;9(1):3765.  PubMed