Anti TMED5 pAb (ATL-HPA050289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050289-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TMED5
Alternative Gene Name: CGI-100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063406: 89%, ENSRNOG00000000073: 88%
Entrez Gene ID: 50999
Uniprot ID: Q9Y3A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL |
| Gene Sequence | FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL |
| Gene ID - Mouse | ENSMUSG00000063406 |
| Gene ID - Rat | ENSRNOG00000000073 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMED5 pAb (ATL-HPA050289) | |
| Datasheet | Anti TMED5 pAb (ATL-HPA050289) Datasheet (External Link) |
| Vendor Page | Anti TMED5 pAb (ATL-HPA050289) at Atlas Antibodies |
| Documents & Links for Anti TMED5 pAb (ATL-HPA050289) | |
| Datasheet | Anti TMED5 pAb (ATL-HPA050289) Datasheet (External Link) |
| Vendor Page | Anti TMED5 pAb (ATL-HPA050289) |
| Citations for Anti TMED5 pAb (ATL-HPA050289) – 1 Found |
| Nguyen, Duy; Stutz, Regine; Schorr, Stefan; Lang, Sven; Pfeffer, Stefan; Freeze, Hudson H; Förster, Friedrich; Helms, Volkhard; Dudek, Johanna; Zimmermann, Richard. Proteomics reveals signal peptide features determining the client specificity in human TRAP-dependent ER protein import. Nature Communications. 2018;9(1):3765. PubMed |