Anti TMED3 pAb (ATL-HPA076949)

Atlas Antibodies

Catalog No.: ATL-HPA076949-25

Protein Description: transmembrane p24 trafficking protein 3
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
• Gene Sequence: DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
• Gene ID - Mouse: ENSMUSG00000032353
• Gene ID - Rat: ENSRNOG00000013889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.