Anti TMED3 pAb (ATL-HPA076949)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076949-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMED3
Alternative Gene Name: C15orf22, p24B, p24g4, p24gamma4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032353: 80%, ENSRNOG00000013889: 83%
Entrez Gene ID: 23423
Uniprot ID: Q9Y3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DPQGNTIYRETKKQYDSFTYRAEVKGVYQF |
Gene Sequence | DPQGNTIYRETKKQYDSFTYRAEVKGVYQF |
Gene ID - Mouse | ENSMUSG00000032353 |
Gene ID - Rat | ENSRNOG00000013889 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMED3 pAb (ATL-HPA076949) | |
Datasheet | Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link) |
Vendor Page | Anti TMED3 pAb (ATL-HPA076949) at Atlas Antibodies |
Documents & Links for Anti TMED3 pAb (ATL-HPA076949) | |
Datasheet | Anti TMED3 pAb (ATL-HPA076949) Datasheet (External Link) |
Vendor Page | Anti TMED3 pAb (ATL-HPA076949) |