Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050539-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane emp24-like trafficking protein 10 (yeast)
Gene Name: TMED10
Alternative Gene Name: P24(DELTA), TMP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021248: 94%, ENSRNOG00000007901: 94%
Entrez Gene ID: 10972
Uniprot ID: P49755
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYD
Gene Sequence SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYD
Gene ID - Mouse ENSMUSG00000021248
Gene ID - Rat ENSRNOG00000007901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation)
Datasheet Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation)
Datasheet Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMED10 pAb (ATL-HPA050539 w/enhanced validation)