Anti TMED1 pAb (ATL-HPA018507)

Atlas Antibodies

Catalog No.: ATL-HPA018507-25

Protein Description: transmembrane emp24 protein transport domain containing 1
Gene Name: TMED1
Alternative Gene Name: Il1rl1l, IL1RL1LG, MGC1270, ST2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032180: 100%, ENSRNOG00000008037: 100%
Entrez Gene ID: 11018
Uniprot ID: Q13445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
• Gene Sequence: PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
• Gene ID - Mouse: ENSMUSG00000032180
• Gene ID - Rat: ENSRNOG00000008037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMED1 pAb (ATL-HPA018507) – 1 Found

Connolly, Dympna J; O'Neill, Luke A J; McGettrick, Anne F. The GOLD domain-containing protein TMED1 is involved in interleukin-33 signaling. The Journal Of Biological Chemistry. 2013;288(8):5616-23.