Anti TMCO3 pAb (ATL-HPA048126)

Atlas Antibodies

SKU: ATL-HPA048126-25

• 
• 

Protein Description: transmembrane and coiled-coil domains 3
Gene Name: TMCO3
Alternative Gene Name: C13orf11, FLJ20623
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038497: 93%, ENSRNOG00000019346: 93%
Entrez Gene ID: 55002
Uniprot ID: Q6UWJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL
• Gene Sequence: RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL
• Gene ID - Mouse: ENSMUSG00000038497
• Gene ID - Rat: ENSRNOG00000019346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.