Anti TMCO3 pAb (ATL-HPA048126)

Atlas Antibodies

SKU:
ATL-HPA048126-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic positivity in subset of glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane and coiled-coil domains 3
Gene Name: TMCO3
Alternative Gene Name: C13orf11, FLJ20623
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038497: 93%, ENSRNOG00000019346: 93%
Entrez Gene ID: 55002
Uniprot ID: Q6UWJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL
Gene Sequence RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL
Gene ID - Mouse ENSMUSG00000038497
Gene ID - Rat ENSRNOG00000019346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMCO3 pAb (ATL-HPA048126)
Datasheet Anti TMCO3 pAb (ATL-HPA048126) Datasheet (External Link)
Vendor Page Anti TMCO3 pAb (ATL-HPA048126) at Atlas Antibodies

Documents & Links for Anti TMCO3 pAb (ATL-HPA048126)
Datasheet Anti TMCO3 pAb (ATL-HPA048126) Datasheet (External Link)
Vendor Page Anti TMCO3 pAb (ATL-HPA048126)