Anti TMCO1 pAb (ATL-HPA078775)

Atlas Antibodies

Catalog No.:
ATL-HPA078775-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane and coiled-coil domains 1
Gene Name: TMCO1
Alternative Gene Name: HP10122, TMCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052428: 100%, ENSRNOG00000003928: 100%
Entrez Gene ID: 54499
Uniprot ID: Q9UM00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRM
Gene Sequence YRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRM
Gene ID - Mouse ENSMUSG00000052428
Gene ID - Rat ENSRNOG00000003928
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMCO1 pAb (ATL-HPA078775)
Datasheet Anti TMCO1 pAb (ATL-HPA078775) Datasheet (External Link)
Vendor Page Anti TMCO1 pAb (ATL-HPA078775) at Atlas Antibodies

Documents & Links for Anti TMCO1 pAb (ATL-HPA078775)
Datasheet Anti TMCO1 pAb (ATL-HPA078775) Datasheet (External Link)
Vendor Page Anti TMCO1 pAb (ATL-HPA078775)