Anti TMCC1 pAb (ATL-HPA053894)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053894-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMCC1
Alternative Gene Name: KIAA0779
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030126: 93%, ENSRNOG00000011614: 91%
Entrez Gene ID: 23023
Uniprot ID: O94876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVLQQIRVPPKMKRGTSLHSRRGKPEAPKGSPQINRKSGQEMTAVMQSGRPRSSST |
Gene Sequence | RVLQQIRVPPKMKRGTSLHSRRGKPEAPKGSPQINRKSGQEMTAVMQSGRPRSSST |
Gene ID - Mouse | ENSMUSG00000030126 |
Gene ID - Rat | ENSRNOG00000011614 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMCC1 pAb (ATL-HPA053894) | |
Datasheet | Anti TMCC1 pAb (ATL-HPA053894) Datasheet (External Link) |
Vendor Page | Anti TMCC1 pAb (ATL-HPA053894) at Atlas Antibodies |
Documents & Links for Anti TMCC1 pAb (ATL-HPA053894) | |
Datasheet | Anti TMCC1 pAb (ATL-HPA053894) Datasheet (External Link) |
Vendor Page | Anti TMCC1 pAb (ATL-HPA053894) |