Anti TMC8 pAb (ATL-HPA054429)

Atlas Antibodies

Catalog No.:
ATL-HPA054429-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane channel-like 8
Gene Name: TMC8
Alternative Gene Name: EVER2, EVIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050106: 89%, ENSRNOG00000046086: 84%
Entrez Gene ID: 147138
Uniprot ID: Q8IU68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS
Gene Sequence VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS
Gene ID - Mouse ENSMUSG00000050106
Gene ID - Rat ENSRNOG00000046086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMC8 pAb (ATL-HPA054429)
Datasheet Anti TMC8 pAb (ATL-HPA054429) Datasheet (External Link)
Vendor Page Anti TMC8 pAb (ATL-HPA054429) at Atlas Antibodies

Documents & Links for Anti TMC8 pAb (ATL-HPA054429)
Datasheet Anti TMC8 pAb (ATL-HPA054429) Datasheet (External Link)
Vendor Page Anti TMC8 pAb (ATL-HPA054429)