Anti TMC8 pAb (ATL-HPA054429)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054429-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMC8
Alternative Gene Name: EVER2, EVIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050106: 89%, ENSRNOG00000046086: 84%
Entrez Gene ID: 147138
Uniprot ID: Q8IU68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS |
Gene Sequence | VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS |
Gene ID - Mouse | ENSMUSG00000050106 |
Gene ID - Rat | ENSRNOG00000046086 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMC8 pAb (ATL-HPA054429) | |
Datasheet | Anti TMC8 pAb (ATL-HPA054429) Datasheet (External Link) |
Vendor Page | Anti TMC8 pAb (ATL-HPA054429) at Atlas Antibodies |
Documents & Links for Anti TMC8 pAb (ATL-HPA054429) | |
Datasheet | Anti TMC8 pAb (ATL-HPA054429) Datasheet (External Link) |
Vendor Page | Anti TMC8 pAb (ATL-HPA054429) |