Anti TMC6 pAb (ATL-HPA051430)

Atlas Antibodies

Catalog No.:
ATL-HPA051430-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane channel-like 6
Gene Name: TMC6
Alternative Gene Name: EVER1, EVIN1, LAK-4P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025572: 79%, ENSRNOG00000053469: 44%
Entrez Gene ID: 11322
Uniprot ID: Q7Z403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT
Gene Sequence YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT
Gene ID - Mouse ENSMUSG00000025572
Gene ID - Rat ENSRNOG00000053469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMC6 pAb (ATL-HPA051430)
Datasheet Anti TMC6 pAb (ATL-HPA051430) Datasheet (External Link)
Vendor Page Anti TMC6 pAb (ATL-HPA051430) at Atlas Antibodies

Documents & Links for Anti TMC6 pAb (ATL-HPA051430)
Datasheet Anti TMC6 pAb (ATL-HPA051430) Datasheet (External Link)
Vendor Page Anti TMC6 pAb (ATL-HPA051430)