Anti TMC6 pAb (ATL-HPA051430)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051430-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMC6
Alternative Gene Name: EVER1, EVIN1, LAK-4P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025572: 79%, ENSRNOG00000053469: 44%
Entrez Gene ID: 11322
Uniprot ID: Q7Z403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT |
| Gene Sequence | YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT |
| Gene ID - Mouse | ENSMUSG00000025572 |
| Gene ID - Rat | ENSRNOG00000053469 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMC6 pAb (ATL-HPA051430) | |
| Datasheet | Anti TMC6 pAb (ATL-HPA051430) Datasheet (External Link) |
| Vendor Page | Anti TMC6 pAb (ATL-HPA051430) at Atlas Antibodies |
| Documents & Links for Anti TMC6 pAb (ATL-HPA051430) | |
| Datasheet | Anti TMC6 pAb (ATL-HPA051430) Datasheet (External Link) |
| Vendor Page | Anti TMC6 pAb (ATL-HPA051430) |