Anti TMC3 pAb (ATL-HPA040265)

Atlas Antibodies

Catalog No.:
ATL-HPA040265-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane channel-like 3
Gene Name: TMC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038540: 63%, ENSRNOG00000025088: 60%
Entrez Gene ID: 342125
Uniprot ID: Q7Z5M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPMTFTTHIEDVHSEPLFRKDFQQINPPHRGPQASTLLAQGPRPHAPRYYVINEYDSYKKKHLNVWPERHFKIDASGDIVELYPRNV
Gene Sequence TPMTFTTHIEDVHSEPLFRKDFQQINPPHRGPQASTLLAQGPRPHAPRYYVINEYDSYKKKHLNVWPERHFKIDASGDIVELYPRNV
Gene ID - Mouse ENSMUSG00000038540
Gene ID - Rat ENSRNOG00000025088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMC3 pAb (ATL-HPA040265)
Datasheet Anti TMC3 pAb (ATL-HPA040265) Datasheet (External Link)
Vendor Page Anti TMC3 pAb (ATL-HPA040265) at Atlas Antibodies

Documents & Links for Anti TMC3 pAb (ATL-HPA040265)
Datasheet Anti TMC3 pAb (ATL-HPA040265) Datasheet (External Link)
Vendor Page Anti TMC3 pAb (ATL-HPA040265)