Anti TMBIM4 pAb (ATL-HPA077642)

Atlas Antibodies

Catalog No.: ATL-HPA077642-25

Protein Description: transmembrane BAX inhibitor motif containing 4
Gene Name: TMBIM4
Alternative Gene Name: CGI-119, GAAP, LFG4, S1R, ZPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020225: 32%, ENSRNOG00000004312: 33%
Entrez Gene ID: 51643
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL
• Gene Sequence: RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL
• Gene ID - Mouse: ENSMUSG00000020225
• Gene ID - Rat: ENSRNOG00000004312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.