Anti TMA16 pAb (ATL-HPA052688)

Atlas Antibodies

Catalog No.:
ATL-HPA052688-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: translation machinery associated 16 homolog
Gene Name: TMA16
Alternative Gene Name: C4orf43, FLJ11184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025591: 82%, ENSRNOG00000014188: 84%
Entrez Gene ID: 55319
Uniprot ID: Q96EY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMER
Gene Sequence KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMER
Gene ID - Mouse ENSMUSG00000025591
Gene ID - Rat ENSRNOG00000014188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMA16 pAb (ATL-HPA052688)
Datasheet Anti TMA16 pAb (ATL-HPA052688) Datasheet (External Link)
Vendor Page Anti TMA16 pAb (ATL-HPA052688) at Atlas Antibodies

Documents & Links for Anti TMA16 pAb (ATL-HPA052688)
Datasheet Anti TMA16 pAb (ATL-HPA052688) Datasheet (External Link)
Vendor Page Anti TMA16 pAb (ATL-HPA052688)