Anti TM9SF4 pAb (ATL-HPA064099)

Atlas Antibodies

SKU: ATL-HPA064099-25

• 
• 
• 

Protein Description: transmembrane 9 superfamily protein member 4
Gene Name: TM9SF4
Alternative Gene Name: dJ836N17.2, KIAA0255
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068040: 98%, ENSRNOG00000009406: 96%
Entrez Gene ID: 9777
Uniprot ID: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
• Gene Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
• Gene ID - Mouse: ENSMUSG00000068040
• Gene ID - Rat: ENSRNOG00000009406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.